• ChEMBL_18 Released




    We are pleased to announce the release of ChEMBL_18. This version of the database was prepared on 12th March 2014 and contains:
    • 1,566,466 compound records
    • 1,359,508 compounds (of which 1,352,681 have mol files)
    • 12,419,715 activities
    • 1,042,374 assays
    • 9,414 targets
    • 53,298 documents

    The web front end at https://www.ebi.ac.uk/chembl is now connected to the ChEMBL 18 data, but you can also download the data from the ChEMBL ftpsite. Please see ChEMBL_18 release notes for full details of all changes in this release.

    Changes since the last release

     

    New data sets

     

    The ChEMBL_18 release includes the following new datasets:
    • University of Vienna G-glycoprotein (pgp) screening data
    • UCSF MMV Malaria Box screening data
    • DNDi Trypanosoma cruzi screening data
    • DrugMatrix in vivo toxicology data
    In addition, 43,335 new compound records from 2015 publications in the primary literature have been added to this release. Approved drug and usan data have also been updated, with 103 new structures added.

     

    Updates to the protein family classification

     

    A review and update of the ChEMBL protein family classification has been carried out. The main changes are listed below:

    • New ion channel/transporter classification, based on the BPS classification
    • New epigenetic protein classification, based on SGC/ChromoHub classification
    • Modification of kinase classification, to follow Human Kinome classification

     

    Assay classification and ontology mapping

     

    The following annotations and classifications have been added to the ChEMBL assay data:
    • Classification of assay format (e.g., biochemical, cell-based, organism-based) using BioAssay Ontology
    • Classification of endpoints (e.g., IC50, AUC, Ki) using BioAssay Ontology
    • Addition of Physicochemical and Toxicity assay type classification
    • Mapping of assay cell-lines to CLO, EFO and Cellosaurus
    • Mapping of standard units to Unit Ontology and QUDT

     

     

    Capture of assay parameters

     

    A new table in the database (assay_parameters), is used to capture additional properties of assays such as dose, administration route, time points. These additional parameters are displayed on the Assay Report Card.

     

    Target predictions

     

    Bioactivity data for single protein targets in ChEMBL have been used to train and validate two Naive Bayesian multi-label classifier models (at <= 1uM and <= 10uM bioactivity cutoffs respectively). These models have been subsequently employed to predict biological targets for a set of approved drugs, which are displayed on in the new Target Predictions section of the Compound Report Card, where applicable. Since some of the predictions correspond to compound/target pairs that were included in the training set for the models, these are shown in white, to distinguish them from genuine predictions (coloured light yellow). Only predictions scoring >= 0.2 are included in the result tables. The models were built with open source tools such as RDKit and scikit-learn and are available upon request.



    We would appreciate any feedback on this feature, and any further ideas you may have on including predicted data on top of ChEMBL experimental data.

     

    UniChem connectivity mapping

     

    In addition to the standard UniChem cross-references shown on the report card (based on exact InChI Key matching), a new link is included to an expanded view of UniChem cross-references, generated based on InChI connectivity layer matching (e.g.,

    https://www.ebi.ac.uk/chembl/compound/unichem_connectivity/GJJFMKBJSRMPLA-DZGCQCFKSA-N). 

    This expanded view shows any compounds in UniChem that share the same connectivity as the query structure, even if they have stereochemical, isotopic or protonation state differences. The differences between the query and retrieved structures are shown by their position in the table: the first column shows compounds that match in all InChI layers, while the subsequent columns show those structures that differ in stereochemistry (s column), isotope (i column), protonation state (p column), or various combinations of these layers (final four columns). A button at the top of the table gives the additional option to retrieve compounds that match individual components of a mixture or salt. Where the query structure consists of multiple components, matches to each of these components will be coloured different colours (e.g., black, blue, red). 

     

    ChEMBL RDF Update

     

    The ChEMBL RDF data model has been enhanced and now includes the following information:
    • Drug mechanism of action and binding site information
    • Molecule hierarchy
    • Target relationships
    • Assay format
    • Cell-line information
    More information (documentation, SPARQL endpoint and example queries), about the RDF version of the ChEMBL database can be found on the EBI-RDF Platform and you can download the RDF files from the ChEMBL ftpsite.

     

    Web Service Update

     

    Three new Web Service calls focused on approved drugs, mechanism of action and compound forms are now available. Example calls to these methods can be seen below and also please visit the ChEMBL Web Service page for more details.


    http://www.ebi.ac.uk/chemblws/targets/CHEMBL1824/approvedDrug.json
    http://www.ebi.ac.uk/chemblws/compounds/CHEMBL1642/drugMechanism.json
    http://www.ebi.ac.uk/chemblws/compounds/CHEMBL278020/form.json



    As always, we greatly appreciate to reporting of any omissions or errors.

    The ChEMBL Team

  • Catching up on all those GPCR structures that keep being published


    I've missed quite a few rhodopsin-like GPCR structures, so catching up on some of this today. Below are representative structures of all the 22 sequence distinct rhodopsin-like GPCRs which are in the public domain as of today. I've done an initial alignment, and the areas the ambiguities are in, are variable between structures, and also within structure sets (same sequence, different ligand, cell, etc). It is incredible that there are now 22 of these, and of course, representative structures of some of the other GPCR superfamilies too.
    1. 4dkl - mouse mu opioid receptor 
    2. 4ej4 - mouse delta opioid receptor
    3. 4djh - human kappa opioid receptor
    4. 4ea3 - human nociceptin receptor
    5. 3odu - human CXCR4 receptor 
    6. 2lnl - human CXCR1 receptor (NMR)
    7. 4mbs - human CCR5 receptor
    8. 3vw7 - human PAR1 receptor
    9. 4ntj - human P2Y12 receptor
    10. 4grv - rat neurotensin receptor
    11. 3uon - human muscarinic M2 receptor 
    12. 4daj - rat muscarinic M3 receptor 
    13. 3rze - human histamine H1 receptor
    14. 2rh1 - human beta-2 adrenergic receptor 
    15. 2vt4 - turkey beta-1 adrenergic receptor 
    16. 4iaq - human 5HT1B receptor
    17. 3pbl - human dopamine D3 receptor
    18. 1ib4 - human 5HT2B receptor
    19. 2ydv - human adenosine A2a receptor 
    20. 3v2w - human sphingosine-1-phosphate receptor
    21. 1u19 - bovine rhodopsin
    22. 2z73 - squid rhodopsin
                               10        20        30        40        50        60        70    
    4dkl   (  65 )                                             mvtaitimalYsiVcvvGlfgNflvmyvIvrytk
    4ej4   (  41 )                                        rsasslalaiaitalYsavcavGllgNvlvmfgIvrytk
    4djhA  (  55 )                                            spaipviitavysvvfvvGlvgNslVmfVIirytk
    4ea3A  (  47 )                                            plglkvtIvglYlavcvgGllgNclvmyVIlrhtk
    3oduA  (  27 )            pçfre-------------------------enanfnkiflptiYsiIfltGivgNglvilvMgyqkk
    2lnl   (  29 )            pÇmle--------------------------tetLnkYvviiayalvFllsllgNslvMlvilysrv
    4mbsA  (  19 )            pçqki-------------------------nvkqiaarllpplYslvfifGfvgNmlViliLinykr
    3vw7   (  91 )                                     dasgYLtsswLtlfVPsvYtgVfvvSlplNimaivvFilkmk
    4ntj   (  16 )            lÇtr---------------------------dykitqvlfPllYtvLffvGlitNglAmriFfqir-
    4grvA  (  52 )                                    nsdldVnTdiyskvlvtaiYlalfvvGtvgNsvtlftlark s
    3uon   (  20 )                                             tfevvfivlvagslSlvTiigNilVmvSIkvnrh
    4dajA  (  64 )                                             iwqvvfiafltgflAlvTiigNilVivAFkvnkq
    3rze   (  28 )                                                 mplvvvlsticlvTvglNllVlyAvrserk
    2rh1   (  29 )                                            devwvvgmgivmslivlaIvfgNvlVitAIakfer
    2vt4A  (  40 )                                               weagmsllmalVvllIvagNvlViaAigstqr
    4iaq   (  38 )                                     yiyQdsislpwkvllvmllalitlaTtlsNafViatVyrtrk
    3pblA  (  32 )                                                   yalsYcalilaIvfgNglVcmAVlkera
    4ib4   (  48 )                                          eeqgnklhwAallilmviipTigGNtlVilAVslekk
    2ydv   (   3 )                                             imgssvYitvElaiavlAilgNvlVcwAvwlnsn
    3v2w   (  17 )           sdyvnydIIvrHYnyTgklnisa                ltsvvfiliCcfIileNifvlltiwktkk
    1u19A  (   1 )            mnGtegpnfyVPfsnktgvVrsPFeapQyyLaepwqFsmlAayMflLimlGfpiNflTlyVTvqHkk
    2z73A  (   9 )         etwwyNpsIvVhpHWref--------------dqvpdavYyslGifIgiCgiiGcggNgiViyLFtktks
                                                                  aaaaaaaaaaaaaaaaaaaaaaaaaaaa   
    
                          80        90        100       110       120       130       140       150 
    4dkl   (  99 )    MktAtniYIfNLAlADalATsTLpfqsvnylmg---tWpfgnilÇkiviSidYyNMFTSIfTLctMSvdRyiAVC
    4ej4   (  80 )    LktATniYIfNLAlADalATstLpfqsakylme---tWpfgellÇkaVlSidYyNMFTSIfTLtmMSvDRyiavc
    4djhA  (  90 )    mktaTniYIfNLAlADalVTtTMpfqstvylmn---sWpfgdvlÇkiVlsiDyyNMfTSIfTLtmMSvdRyiaVc
    4ea3A  (  82 )    mktatNiYIfNLAlADtlVLlTLpfQGtdillg---fWpfgnalÇktVIaiDyyNMFTSTfTLtaMSvdryvaic
    3oduA  (  69 )    lrsmtdkYRlhLSvADllFVitLpfWavDAva----nWyfgnflÇkaVHviYTVNlYSSVwILAfISlDRylAiV
    2lnl   (  70 )    GrsvTdvyLlnLalaDllfaltlpiwaaSkvn----gwifgtfLÇkvVslLkEvnfYsgilLlacIsvdrylaiv
    4mbsA  (  61 )    lksMtdIYLlnLAiSdlfFLlTVpfWahyaaaq----WdfgntmÇqlLTglYFiGFFSgIfFIilLTiDRylaVv
    3vw7   ( 133 )    vkkPAVVyMlhLAtADvlFVsvLpfkisYyfsg--SdWqfgselÇrfVtAaFYcnMYASIlLMtvISiDrflAVv
    4ntj   (  55 )    sksnFiIFLknTViSDllMIltFpfkilsdakl      lrtfvcqvtsVifyfTMYISIsFLGlITidryqktt
    4grvA  (  98 )    lqstvhyHlgsLalSDllILllAMpvElyNFIWvhhpWafgdagÇrgyYflRDactYATAlNVasLSvaRylAic
    3uon   (  54 )    LqtvnnyflfSLAcADliiGvfSMnlytlytvi--gyWplgpvvÇdlWlalDYvVSNAsVmNLliiSfdryfcvt
    4dajA  (  98 )    LktvnnyFllSLAcADliIGviSMnlFttyiim--nrWalgnlaÇdlwLSiDYvASNAsVmNLlvISfDryfsit
    3rze   (  58 )    LhtvGnlYIvsLSvADliVGavVMpmnilyllm--skwsLgrplÇlfWLSmDYVASTASIfSVfiLCiDryrsvq
    2rh1   (  64 )    LqtvtnyFItsLAcADlvMGlaVVpfgaahilm--kmWtfgnfwçefWTSiDVlCVTASIeTLcvIAvdryfAIt
    2vt4A  (  72 )    LqtltnlFItsLAcADlvvGllVVpfgatlvvr--gtWlwgsflçelWTSlDVlCVTAsIeTLcvIAiDrylait
    4iaq   (  80 )    LhtpanyLiasLAvTDllVSilVMpiStmytvt--grWtlgqvvÇdfWlssDItCCTASIwHLCviAldrywait
    3pblA  (  60 )    LqtttnyLVvsLAvADllvAtlVMpwvvylevt-ggvWnfsricÇdvFVTlDVmMcTAsIwNLCaISidRytAVv
    4ib4   (  85 )    LqyatnyFlmsLAvADllVGlfVMpiaLltimf-eamWplplvlÇpawLflDVlfSTASIwHLCaIsvdryiaIk
    2ydv   (  37 )    LqnvtnyFVvsAAaADilVGvlAIpfaiaIst----GfçaaçhgÇLfiACfVLVLTASSIfSLlaIAiDryiair
    3v2w   (  76 )    FhrpMYyFIgnLAlSDllaGvaYtaNlllsga---tTykLtPaqWFlREGsMFvALSASVfSLlaIAieryitml
    1u19A  (  68 )    LrtplNyILlnLAvADlfMVfg-GFtTTlyTSl-hGyFvfgptGÇnlEGffATLGGEIaLWSLvvLaieRyvvVc
    2z73A  (  65 )    LqtpanmFiinLAfSDftFSlvNGfplMtiSCf-lkkWifgfaaÇkvYGfiGGiFGFMsIMTMAMiSiDrynViG
                         aaaaaaaaaaaaaaaaaa aaaaaaaaa          aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    
                               160       170       180       190       200       210       220   
    4dkl   ( 171 )    hpvkaldf---rtprnAkivnvcNwilSsaiGlpVmfmAttkyrqg--------------sidçtltfsh-ptwy
    4ej4   ( 152 )    hpvkaldf---rtpakAklinicIwvlAsgvGvpimvmAvtqprdg--------------avvÇmlqfps-pswy
    4djhA  ( 162 )    hpvkaldf---rtplkAkiinicIwllSssvGisAivlGGtkvred------------vdvieÇslqFpdddysw
    4ea3A  ( 154 )    hp          tsskAqavnvaIwalAsvvGvpvaimGsAqvede--------------eieÇlveipt-pqdy
    3oduA  ( 140 )    hatn---sqrprkllAekvVyvgVwipAlllT-ipDfif--Anvsead-----------dryiÇdrfyp---ndl
    2lnl   ( 141 )    haTr----tltqkrhlvkfvclgcwglsmnlS-lpFflf--RQayhpN----------NsSPvÇyEVlg-ndtak
    4mbsA  ( 132 )    havfAlka---rtvtfGvvtsvitwvvAvfaS-lpNiif--Trsqkeg-----------lhytÇsshfpysqyqf
    3vw7   ( 206 )    ypm        rtlgrAsftClaiwalAiagV-vpLllkeQtiqvpg-----------lgitTçhdvlsetLleg
    4ntj   ( 128 )    rpfkt      knllgAkilsvviwafMfllS-lpNmil                              ksefgl
    4grvA  ( 173 )    hpfkaktl---msrsrtkkfisaIwlaSallAipMlftMGlqnrSadg--------thpgGlVÇTPiv----dta
    3uon   ( 127 )    kpltypvk---rttkmAgmmiaaAwvlSfilwapaIlfwqfivg-----------vrtVedgeÇyIqff------
    4dajA  ( 171 )    rpltyrak---rttkrAgvmiglAwviSfvlWApaIlfwqyfvg-----------krtVppgeÇfIqfl------
    3rze   ( 131 )    qplrylky---rtktrAsatilgawflSfl-WvipIlgwnh                 rredkÇeTdfy------
    2rh1   ( 137 )    spfkyqSl---ltknkArviilmvwivSgltSflpIqmhwyr-----athqeAinÇyae-etçÇdff--------
    2vt4A  ( 145 )    spfryqsl---mtrarAkviictvwaiSalvSflpImmhwWr-----dedpqAlkçyqd-pgçÇdfv--------
    4iaq   ( 153 )    daveysak---rtpkraavmialvwvfSisISl-pPffwrqa                   seÇvvntd------
    3pblA  ( 134 )    mpvhyqhgtgqsscrrValmitavwvlAfaVSc-pLlfgfNtTg---------------dptvÇsIs--------
    4ib4   ( 159 )    kpiqanqy---nsratAfikitvVwliSigiAi-pVpikgiet              npnnitÇvLtke------
    2ydv   ( 108 )    iplryngl---vtgtrAkgiiaicwvlSfaIGltPmlgwnnÇgqp--kegkahsqgÇgegqvAÇlFedVV-----
    3v2w   ( 148 )    k           nnfrlfllisacwviSlilGglPimgwn----------------ÇisalssÇSTVLP------
    1u19A  ( 141 )    kpmsn----frfgenhaimgvafTwvmAlaCAapPlvgwSrYIPE-------------GMQCSÇGIDYYTpheet
    2z73A  ( 139 )    rpmaas---kkMshrrAfimiifVwlwSvlwAigPifgwGaYtLE-------------GVLCNÇSFdYIsr--ds
                                   aaaaaaaaaaaaaaaaaaa  aaa                                      
    
                          230       240       250       260       270       280       290       300 
    4dkl   ( 228 )    wenllKicVfifAfimPvliItvcyglmilrlksvr                   ekdrnlrritrMVlvVvavF
    4ej4   ( 209 )    wdtvtkicvflfAfvvPiliitvcyglMllrlrsvr                   ekdrslrriTrMVlvVvgaF
    4djhA  ( 222 )    wdlfmkicVfifAfviPvliIivcytlMilrlksvrllsg              rekdrnlrritrLVlvVVavF
    4ea3A  ( 211 )    wgpvfaiciflfSFivPvlvIsvcyslMirrlrgvrlls-------------gsrekdrnlrritrLVlvVvavF
    3oduA  ( 195 )    wvvvfqfqhimvglilPgivIlsCyciIisklshs                     kghqkrkalktTviLilaF
    2lnl   ( 198 )    wrmvLrilPHtfGfivplfvmlfcygftlrtlf---------------------kahmgqkhrAmrvIfaVvlif
    4mbsA  ( 190 )    wknfQTlkIVilGlvlPllvmvicysgIlktllr                       ekkrhrdvrlIftIMivY
    3vw7   ( 266 )    yyayyfsafSavfFfvpliiStvCyvsIirclsssa                   anrskksrAlfLSaaVfcIF
    4ntj   ( 185 )    vwheiVnyiCqviFwinfliVivcYtlItkelyrsyvrt              rgvgkv rkkvnvkvfiIiaVF
    4grvA  ( 233 )    tvkvvIqvNtfmSFlfPmlvIsilNtvIAnkLtvmv                     vqalrhGVlvAraVviaf
    3uon   ( 182 )    snaavtfgtAiaaFylpviiMtvlywhisrasksri                   pppsrekkvtrtilaIllaF
    4dajA  ( 226 )    septitfgtAiaaFymPvtiMtilywrIyketek                       like   aqTlsaIllaF
    3rze   ( 186 )    dvtwfkvmtaiinFylPtllMlwfyakIykaVrqhc                   lhmnrerkaakQLgfIMaaF
    2rh1   ( 195 )    TnqayaiasSivSFyvplviMvfvYsrVfqeakrql                   kfclkeHkaLktlgiIMgtF
    2vt4A  ( 203 )    TnrayaiasSiiSFyipLliMifvalrvyreakeq                       irehkalktlgiImgvF
    4iaq   ( 205 )    -hilytvySTvgAFyfPtllLialygrIyvearsri                   lmaarerkaTktLgiIlgaF
    3pblA  ( 185 )    -npdFViySSvvSFylPfgvTvlvyarIyvvlkqrrrk-----------------gvplrekkatqMVaiVlgaF
    4ib4   ( 213 )    rFgdfMlfgSlaAFftPlaiMivtyfltihALqkka                   qtisneqraskvlgivFflF
    2ydv   ( 173 )    pmnYMVyfNffaCVlvPlllMlgvylrIflaarrqlkqmesq             stlqkevhaakSLaiIvglF
    3v2w   ( 197 )    LYhkhYIlfCTtvFtllllsIvilYcriyslvrtr                   asrssenvaLlkTViiVLsvF
    1u19A  ( 199 )    nNesFViyMfvvHfiiPlivIffcygqLvftvkeaaaq------------qqesattqkaekevTrMviiMviaF
    2z73A  ( 196 )    ttrsNIlcMFilGffgPiliiffCyfnIvmsvsnhekemaamakrlnakelrkaqaganaemrlAkIsivIVsqF
                        aaaaaaaaaaa aaaaaaaaaaaaaaaaa                            aaaaaaaaaaaaaaaa
    
                               310       320       330       340       350       360       370   
    4dkl   ( 290 )    ivcWtpIHiyViikaliti--------pettfqtvswhfcialGYtNSclNpvlYafldenFkrCfrefci    
    4ej4   ( 271 )    vvCWapIHifVivwtlvdi-------nrrdplvvaalhlcialGYaNSslNpvlYaflDenfkrc          
    4djhA  ( 284 )    vvcWtpIHifilvealgs             aalssyyfcIalGytNSslNPilYafldenFkrcfrdfcfp   
    4ea3A  ( 273 )    vgcWtpVQvfvlaqglgvq--------pssetavailrfctAlGYvNSclNpilYafldenFkacfr        
    3oduA  ( 249 )    facWlpyyigisidsfillei-ikqgçefentvhkwisitEAlAFfHCclNpilyaflgakfktsaqhalts   
    2lnl   ( 252 )    llcwlpynlvlLadTlmrtq-viqesçeRrNnIGraLdatEilGflhsclnpiiyafigqnfrhgflkilamhg 
    4mbsA  ( 245 )    flfWapYNivLllnTfqeff--glnnçsSsnrldqamqvtetlGMtHCciNpiiYafvgeefrnyllvffq    
    3vw7   ( 323 )    iiCFgpTNvlLiaHYsflsh------tstteaAYfaYLlcvCvSSiSCciDplIyyyAssec             
    4ntj   ( 246 )    fiCFvpFHfaripytlsqtr--dvfdçtaentlfyvkestlwlTSlNAClNpfIYfflcksFrnslism      
    4grvA  ( 318 )    vvcWlpYHvRRlmFCyisdeq---WttflFdfYHyfYmlTNalAYasSAinpilYnlvsanFrqv          
    3uon   ( 397 )    iitWapYNvmVlintfçap--------ç---ipntvwtiGywlCYinstiNpacYalcnatFkktfkhllm    
    4dajA  ( 500 )    iitWtpyNimVlvntfçds--------ç---ipktywnlgywlCYiNStvNPvcYalcnktFrttfkt       
    3rze   ( 425 )    ilCWipYFiffmviafçkn--------ç---cnehlhmftiWlGYiNStlNPliYplCnenFkktfkrilhi   
    2rh1   ( 283 )    tlcWlpFFiVNivhviqdn-----------lirkevyillNwiGYvNSgfNpliYc-rspdfriAfqellcl   
    2vt4A  ( 300 )    tlCWlpFFlvnivnvfnrd-----------lvpdwlfvafnwlGYAnSAmnpiiYc-rspdfrkAfkrlla    
    4iaq   ( 324 )    ivCWlpFFiiSlvmpi                hlaifdffTwlGYlNSliNPiiYtmsnedFkqafhklirfk  
    3pblA  ( 339 )    ivCWlpFFltHvlnthçqt--------ç--hvspelysattwlGYvNsalNPviYttfnieFrkAflkilsc   
    4ib4   ( 334 )    llmWcpFFitNitLvlçds--------çnqttlqmlLeifvWiGYvSSGvNPlvyTlfnktFrdAfgrYitcnyr
    2ydv   ( 243 )    alCWlpLHiiNcftffçpd--------ç-shaplwlMylAivlSHtNSvvNPfiyAyrireFrqTFrkiirshvl
    3v2w   ( 266 )    iacwapLFiLLllDvgçkvk------tç---diLfrAeyfLvlAvlNSgtNPiiytltNkemrrafiri      
    1u19A  ( 262 )    liCWlpYAgvAfyIfthqgsd----------fgpifMTipAFfAKtSAvyNPviYimmnkqFrnCmvttlccgkn
    2z73A  ( 271 )    llSWspYAvvAllAQfgplew----------VtpyaAQlpVMfAKaSaihNPmiYsvsHpkFreAIsqtfpwvLt
                      aaaaaaaaaaaaaaa                  aaaaaaaaaaaaa   aaaaaaaa  aaaaaaaaa       
    
                          380       390       400       410 
    4dkl                                                    
    4ej4                                                    
    4djhA                                                   
    4ea3A                                                   
    3oduA                                                   
    2lnl                                                    
    4mbsA                                                   
    3vw7                                                    
    4ntj                                                    
    4grvA                                                   
    3uon                                                    
    4dajA                                                   
    3rze                                                    
    2rh1                                                    
    2vt4A                                                   
    4iaq                                                    
    3pblA                                                   
    4ib4                                                    
    2ydv   ( 309 )    rqqepfkaa                             
    3v2w                                                    
    1u19A  ( 327 )    plgddeasttVsktetsqvapa                
    2z73A  ( 336 )    ccqfddketeddkdaeteipage               
                                                            
    
    

  • Event: Seminar on Allosteric Drug Design, April 2014


    On April 30th 2014 the University of Strathclyde will host a seminar on Allosteric Drug Design organised by the smsdrug.net collaboration. The goal of the seminar is to bring together academic and industrial researchers with an interest in allosteric drug design and development with a view to identifying future collaborative and funding opportunities.

    The seminar consists of a series of three talks by : Dr. Gerard JP van Westen (EMBL-EBI ; ChEMBL), Prof. Dr. Leonardo Scapozza (University of Geneva) and Dr. Laurent Galibert (Alpine Institute for Drug Discovery). The talks will cover various of drug design in relation to allosteric drug targets. Talks are aimed at a broad audience.

    To register and for further information please go to www.engage.strath.ac.uk/event/125/

  • New Drug Approvals 2014 - Pt. III - Droxidopa (Northera ™)



    ATC Code: Unavailable
    Wikipedia: Droxidopa
    ChEMBL: CHEMBL2103827

    On February 18th the FDA approved Droxidopa (tarde name Northera™) for the treatment of neurogenic orthostatic hypotension (NOH). NOH is a rare, chronic and often debilitating drop in blood pressure upon standing, and is associated with Parkinson's disease, multiple-system atrophy, and pure autonomic failure. Symptoms of NOH include dizziness, light-headedness, blurred vision, fatigue and fainting when a person stands. 

    Target(s)
    Droxidopa (also known as L-DOPS, L-threo-dihydroxyphenylserine, and SM-5688) is a prodrug which can be converted to norepinephrine (noradrenaline) by Aromatic L-amino acid decarboxylase (Uniprot P20711 ; EC 4.1.1.28). Norepinephrine in turn can be converted to epinephrine by Phenylethanolamine N-methyltransferase ( Uniprot P11086 ). Droxidopa can cross the blood brain barrier, contrary to epinephrine and norepinephrine.  Patients with NOH suffer from depleted levels of epinephrine and norepinephrine. Droxidopa increases the levels of both in the peripheral nervous system and leads to an increased heart rate and blood pressure.



    Droxidopa (CHEMBL2103827; Pubchem : 92974 ) is a small molecule drug with a molecular weight of 213.2 Da, an AlogP of -2.92, 3 rotatable bonds, and no rule of 5 violations.

    Canonical SMILES : N[C@@H]([C@H](O)c1ccc(O)c(O)c1)C(=O)O
    InChi: InChI=1S/C9H11NO5/c10-7(9(14)15)8(13)4-1-2-5(11)6(12)3-4/h1-3,7-8,11-13H,10H2,(H,14,15)/t7-,8+/m0/s1


    Dosage
    Droxidopa starting dose is 100mg three times daily (which can be titrated to a maximum of 600 mg three times daily). One dose should be taken in late afternoon at least 3 hours prior to bedtime to reduce the potential for supine hypertension during sleep.

    Warnings
    Neuroleptic malignant syndrome (NMS) has been reported with Droxidopa use during post-marketing surveillance in Japan. NMS is an uncommon but life-threatening syndrome characterized by fever or hyperthermia, muscle rigidity, involuntary movements, altered consciousness, and mental status changes.

    Ischemic Heart Disease, Arrhythmias, and Congestive Heart Failure
    Droxidopa may exacerbate existing ischemic heart disease, arrhythmias and congestive heart failure.

    Pharmacokinetics
    Absorption
    Cmax of droxidopa were reached by 1 - 4 hours post-dose in healthy volunteers. High-fat meals have a moderate impact on droxidopa exposure with Cmax and AUC decreasing by 35% and 20% respectively, and delaying Cmax by approximately 2 hours.

    Distribution
    Droxidopa exhibits plasma protein binding of 75% at 100 ng/mL and 26% at 10,000 ng/mL with an apparent volume of distribution of about 200 L.

    Metabolism
    The metabolism of droxidopa is mediated by catecholamine pathway and not through the cytochrome P450 system. Plasma norepinephrine levels peak within 3 to 4 hours (generally < 1 ng/mL) and variable with no consistent relationship with dose. The contribution of the metabolites of droxidopa other than norepinephrine to its pharmacological effects is not well understood.

    Elimination
    The mean elimination half-life of droxidopa is 2.5 hours. The major route of elimination of droxidopa and its metabolites is via the kidneys.

    Drug Interactions 
    No dedicated drug-drug interaction studies were performed for droxidopa. Carbidopa, a peripheral dopa-decarboxylase inhibitor, could prevent the conversion of droxidopa to norepinephrine outside of the central nervous system (CNS).

    L-DOPA/dopa-decarboxylase inhibitor combination drugs decreased clearance of droxidopa, increased AUC to droxidopa approximately 100%, and increased exposure to 3-OM-DOPS of approximately 50%. However, it was found that the decreased clearance was not associated with a significant need for a different treatment dose or increases in associated adverse events.

    Dopamine agonists, amantadine derivatives, and MAO-B inhibitors do not appear to effect droxidopa clearance, no dose adjustments are required. 

    Pregnancy
    Droxidopa is classified as pregnancy category C. There are no adequate and well controlled trials in pregnant women.

    The license holder is Chelsea Therapeutics, the prescribing information can be found here.

  • New Drug Approvals 2013 - Pt. XXX - Umeclidinium bromide and Vilanterol (Anoro Ellipta™)






    ATC code: R03AL03
    Wikipedia: Umeclidinium bromide (and vilanterol)

    ChEMBL: CHEMBL1187833 (and CHEMBL1198857)

    On December 18, 2013, the FDA approved Anoro Ellipta for the once-daily, long-term maintenance treatment of airflow obstruction in patients with obstructive pulmonary disease (COPD). Anoro is a combination of umeclidinium (62.5 mcg - more details below) and vilanterol inhalation powder (25 mcg - already approved in a different formulation). Ellipta is the single inhaler device:



    The majority of COPD cases are due to cigarette smoking and this lung disease is a leading cause of death in the United States. Patients affected by COPD experience breathing difficulties worsening with the time as well as chronic cough and chest tightness.


    Umeclidinium
    Umeclidinium (also known as umeclidinium bromide, GSK573719A and GSK573719) is a small molecule with a molecular weight of 428.6 Da and AlogP of 3.34, 8 rotatable bounds and no Lipinski's rule of five violation.

    Molecular formula: C29H34NO2
    Canonical SMILES: OC(c1ccccc1)(c2ccccc2)C34CC[N+](CCOCc5ccccc5)(CC3)CC4
    Standard InChI: InChI=1S/C29H34NO2/c31-29(26-12-6-2-7-13-26,27-14-8-3-9-15-27)28-16-19-30(20-17-28,21-18-28)22-23-32-24-25-10-4-1-5-11-25/h1-15,31H,16-24H2/q+1
    Alternate form of the molecule in ChEMBL: CHEMBL523299

    Mechanism of action





    Anoro Ellipta relaxes the muscles located around the airways of the lung to increase the airflow in patients. This mechanism of action is mediated via umeclidinium, anticholinergic stopping muscle tightening in combination with vilanterol, a long-acting beta2-adrenergic agonist (LABA).

    Safety information

    The phase III trials for Anoro Ellipta included seven clinical studies, involving around 6,000 patients with COPD. The mainly reported side-effect were narrowing and obstruction of the respiratory airway (paradoxical bronchospasm), cardiovascular effects, increased pressure in the eyes (acute narrow-angle glaucoma), and worsening of urinary retention.

    Note that Anoro Ellipta is not indicated for the treatment of asthma and displays a boxed warning for this indication.

    Anoro Ellipta is manufactured by GlaxoSmithKline, Research Triangle Park, N.C.

  • New Drug Approvals 2014 - Pt. I Elosulfase Alfa (Vimizim™)


     ATC code: A16AB12
    ChEMBL: CHEMBL2108676

    On February 14, 2014, the FDA approved elosulfase alfa for the treatment of Mucopolysaccharidosis Type IVA (Morquio A syndrome). Elosulfase alfa is intended to replace the missing GALNS enzyme involved in an important metabolic pathway. Absence of this enzyme leads to problems with bone development, growth and mobility.

    Mucopolysaccharidoses comprise a group of lysosomal storage disorders caused by the deficiency of
    specific lysosomal enzymes required for the catabolism of glycosaminoglycans (GAG). Mucopolysaccharidosis IVA (MPS IVA, Morquio A Syndrome) is characterized by the absence or marked reduction in N-acetylgalactosamine-6-sulfatase activity. The sulfatase activity deficiency resultsin the accumulation of the GAG substrates, KS and C6S, in the lysosomal compartment of cells throughout the body. The accumulation leads to widespread cellular, tissue, and organ dysfunction. It is a rare autosomal recessive disease, affecting approximately 800 people in the US, and significantly shortens life expectancy, with most patients dying at an early age. Sulfonase alfa is the first approved treatment for Morquio A syndrome.

    Elosulfase alfa is intended to provide the exogenous enzyme N-acetylgalactosamine-6-sulfatase that will be taken up into the lysosomes and increase the catabolism of the GAGs KS and C6S. Elosulfase alfa uptake by cells into lysosomes is mediated by the binding of mannose-6-phosphate-terminated oligosaccharide chains of elosulfase alfa to mannose-6-phosphate receptors.

     
    N-acetylgalactosamine-6-sulfatase homodimer (from PDB 4FDI)
    Elosulfase alfa is a soluble glycosylated dimeric protein with two oligosaccharide chains per monomer. Each monomeric peptide chain contains 496 amino acids and has an approximate molecular mass of 55 kDa (59 kDa including the oligosaccharides). One of the oligosaccharide chains contains bis-mannose­ 6-phosphate (bisM6P). bisM6P binds a receptor at the cell surface and the binding mediates cellular uptake of the protein to the lysosome. 

    Its sequence is the following:

    >Elosulfase-alfa
    APQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSAN
    PLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPE
    LLKKAGYVSKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARP
    NIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPF
    FLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLH
    VADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWW
    PGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGR
    LMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSG
    VTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQ
    EALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH

    The recommended dose is 2mg per kg given intravenously over a minimum range of 3.5 to 4.5 hours, based on infusion volume, once every week. Pre-treatment with antihistamines with or without antipyretics is recommended 30 to 60 minutes prior to the start of the infusion. The mean AUC0-t at first administration is 238 min x μg/mL, but increases to 577 by week 22 of treatment, likely due to the development of neutralising antibodies. The mean elimination half-life likewise was measured as 7.52 min at first dosage, and 35.9 min at week 22 of treatment.

    Elosulfase alfa comes with a boxed warning for potentially life-threatening anaphylactic reactions in some patients.

    The license holder for Vimizim™is BioMarin, and the full prescribing information can be found here.

  • New Drug Approvals 2014 - Pt. II - Tasimelteon (HetliozTM)



    ATC Code: N05CH
    Wikipedia: Tasimelteon

    On January 31st 2014, the FDA approved Tasimelteon (Tradename: Hetlioz; Research Code(s): VEC-162, BMS-214778), a melatonin receptor agonist, for the treatment of Non-24-hour sleep-wake disorder (Non-24).

    Non-24-hour sleep–wake disorder (Non-24) is a chronic circadian rhythm sleep disorder, mostly affecting blind people. It is characterised by insomnia or excessive sleepiness related to abnormal synchronization between the 24-hour light–dark cycle and the endogenous circadian cycle (slightly longer than 24 hours). This deviation can be corrected by exposure to solar light, which resets the internal clock, however, the loss of photic input, and the absence of light perception in the majority of patients, prevents them from drifting back into normal alignment.

    Tasimelteon is an agonist at melatonin MT1 and MT2 receptors, with a relative greater affinity for MT2. These receptors are thought to be involved in the control of circadian rhythms, consequently, the binding of tasimelteon to these receptors, and the resulting induced somnolence, is believed to be the mechanism by which tasimelteon aids in the synchronisation of the internal circadian clock with the 24-hour light–dark cycle.

    Melatonin receptors (Uniprot accession: P48039 and P49286; ChEMBL ID: CHEMBL2094268) are members of the G-protein coupled receptor 1 family. There are no known 3D structures for these particular proteins though, however there are now several relevant homologous structures of other members of the family (see here for a current list of representative rhodopsin-like GPCR structures).

    The -melteon USAN/INN stem covers selective melatonin receptor agonists. Tasimelteon is the second approved agent in this class, following the approval of Takeda's Ramelteon in 2005. Contrary to its predecessor, tasimelteon is not currently indicated to treat insomnia, and has received orphan-product designation by the FDA. Agomelatine is another member of this class, but only approved in Europe (PMID: 18673165).


    Tasimelteon (IUPAC Name: N-[[(1R,2R)-2-(2,3-dihydro-1-benzofuran-4-yl)cyclopropyl]methyl]propanamide; Canonical smiles: CCC(=O)NC[C@@H]1C[C@H]1c2cccc3OCCc23; ChEMBL: CHEMBL2103822; PubChem: 10220503; ChemSpider: 8395995; Standard InChI Key: PTOIAAWZLUQTIO-GXFFZTMASA-N) is a synthetic small molecule , with a molecular weight of 245.3 Da, 2 hydrogen bond acceptors, 1 hydrogen bond donor, and has an ALogP of 2.2. The compound is therefore fully compliant with the rule of five.

    Tasimelteon is available as oral capsules and the recommended daily dose is one single capsule of 20 mg, taken before bedtime, at the same time every night. The peak concentration (Cmax) is reached at 0.5 to 3 hours after fasted oral administration, and at steady-state in young healthy subjects, the apparent oral volume of distribution (Vd/F) is approximately 56-126 L. Tasimelteon should not be administered with food, since food decreases its bioavailability, lowering the Cmax by 44%, and delaying the Tmax by approximately 1.75 hours. At therapeutic concentrations, tasimelteon is strongly bound to plasma proteins (90%).

    The primary enzymatic systems involved in the biotransformation of tasimelteon in the liver are CYP1A2 and CYP3A4. Therefore, co-administration of tasimelteon with inhibitors of CYP1A2 and CYP3A4 or inducers of CYP3A4 may significantly alter the plasma concentration of tasimelteon. Metabolism of tasimelteon consists primarily of oxidation at multiple sites and oxidative dealkylation resulting in opening of the dihydrofuran ring followed by further oxidation to give a carboxylic acid. Phenolic glucuronidation is the major phase II metabolic route. Following oral administration of radiolabeled tasimelteon, 80% of total radioactivity is excreted in urine and approximately 4% in feces. The mean elimination half-life (t1/2) for tasimelteon is 1.3 ± 0.4 hours.

    The license holder for HetliozTM is Vanda Pharmaceuticals, and the full prescribing information can be found here.

  • Paper: The ChEMBL database: a taster for medicinal chemists


    We have just had this editorial published in Future Medicinal Chemistry. It is a high-level overview of ChEMBL, SureChEMBL and related resources, aimed primarily at medicinal chemists. The Open Access paper is here.

    %T The ChEMBL database: a taster for medicinal chemists
    %J Future Medicinal Chemistry
    %D 2014
    %O DOI:10.4155/fmc.14.8
    %A G. Papadatos
    %A J.P. Overington